Placeholder image of a protein
Icon representing a puzzle

1709: Revisiting Puzzle 63: Spinach Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,808
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 10,301
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,020
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 9,970
  5. Avatar for xkcd 15. xkcd 1 pt. 9,687
  6. Avatar for The Daydreamers 16. The Daydreamers 1 pt. 8,602
  7. Avatar for Macromolecules@MQ 2019 17. Macromolecules@MQ 2019 1 pt. 2,572
  1. Avatar for Merf 61. Merf Lv 1 3 pts. 9,985
  2. Avatar for xbp 62. xbp Lv 1 3 pts. 9,971
  3. Avatar for versat82 63. versat82 Lv 1 3 pts. 9,970
  4. Avatar for Arne Heessels 64. Arne Heessels Lv 1 3 pts. 9,964
  5. Avatar for aznarog 65. aznarog Lv 1 2 pts. 9,961
  6. Avatar for Silvercraft 66. Silvercraft Lv 1 2 pts. 9,925
  7. Avatar for jdmclure 67. jdmclure Lv 1 2 pts. 9,816
  8. Avatar for Pawel Tluscik 68. Pawel Tluscik Lv 1 2 pts. 9,767
  9. Avatar for rabamino12358 69. rabamino12358 Lv 1 2 pts. 9,727
  10. Avatar for harukaff 70. harukaff Lv 1 2 pts. 9,687

Comments