Placeholder image of a protein
Icon representing a puzzle

1709: Revisiting Puzzle 63: Spinach Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,808
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 10,301
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,020
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 9,970
  5. Avatar for xkcd 15. xkcd 1 pt. 9,687
  6. Avatar for The Daydreamers 16. The Daydreamers 1 pt. 8,602
  7. Avatar for Macromolecules@MQ 2019 17. Macromolecules@MQ 2019 1 pt. 2,572
  1. Avatar for Blipperman 71. Blipperman Lv 1 2 pts. 9,630
  2. Avatar for pfirth 72. pfirth Lv 1 1 pt. 9,570
  3. Avatar for thesamster7 73. thesamster7 Lv 1 1 pt. 9,297
  4. Avatar for navn 74. navn Lv 1 1 pt. 9,281
  5. Avatar for toshiue 75. toshiue Lv 1 1 pt. 9,178
  6. Avatar for Vincera 76. Vincera Lv 1 1 pt. 9,095
  7. Avatar for bmate 77. bmate Lv 1 1 pt. 8,894
  8. Avatar for godel9 78. godel9 Lv 1 1 pt. 8,763
  9. Avatar for hajtogato 79. hajtogato Lv 1 1 pt. 8,609
  10. Avatar for Cloudy101 80. Cloudy101 Lv 1 1 pt. 8,602

Comments