Placeholder image of a protein
Icon representing a puzzle

1709: Revisiting Puzzle 63: Spinach Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,808
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 10,301
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,020
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 9,970
  5. Avatar for xkcd 15. xkcd 1 pt. 9,687
  6. Avatar for The Daydreamers 16. The Daydreamers 1 pt. 8,602
  7. Avatar for Macromolecules@MQ 2019 17. Macromolecules@MQ 2019 1 pt. 2,572
  1. Avatar for frostschutz 81. frostschutz Lv 1 1 pt. 8,564
  2. Avatar for Willyanto 82. Willyanto Lv 1 1 pt. 8,398
  3. Avatar for 181818 83. 181818 Lv 1 1 pt. 8,394
  4. Avatar for RockOn 84. RockOn Lv 1 1 pt. 8,185
  5. Avatar for Jiaying Huang 85. Jiaying Huang Lv 1 1 pt. 7,993
  6. Avatar for Dantoto 86. Dantoto Lv 1 1 pt. 7,864
  7. Avatar for heather-1 87. heather-1 Lv 1 1 pt. 7,853
  8. Avatar for NotJim99 88. NotJim99 Lv 1 1 pt. 7,084
  9. Avatar for abiogenesis 89. abiogenesis Lv 1 1 pt. 7,046
  10. Avatar for FoldUp47 90. FoldUp47 Lv 1 1 pt. 7,003

Comments