Placeholder image of a protein
Icon representing a puzzle

1709: Revisiting Puzzle 63: Spinach Protein

Closed since over 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
August 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups


  1. Avatar for Beta Folders 100 pts. 11,200
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 11,167
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,125
  4. Avatar for Go Science 4. Go Science 36 pts. 11,118
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 24 pts. 11,076
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 11,073
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 11,029
  8. Avatar for Contenders 8. Contenders 6 pts. 10,990
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 10,989
  10. Avatar for Russian team 10. Russian team 2 pts. 10,855

  1. Avatar for retiredmichael
    1. retiredmichael Lv 1
    100 pts. 11,186
  2. Avatar for LociOiling 2. LociOiling Lv 1 96 pts. 11,179
  3. Avatar for actiasluna 3. actiasluna Lv 1 92 pts. 11,167
  4. Avatar for christioanchauvin 4. christioanchauvin Lv 1 88 pts. 11,125
  5. Avatar for jobo0502 5. jobo0502 Lv 1 85 pts. 11,103
  6. Avatar for fiendish_ghoul 6. fiendish_ghoul Lv 1 81 pts. 11,091
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 77 pts. 11,086
  8. Avatar for joremen 8. joremen Lv 1 74 pts. 11,084
  9. Avatar for NinjaGreg 9. NinjaGreg Lv 1 71 pts. 11,044
  10. Avatar for Deleted player 10. Deleted player pts. 11,041

Comments