Placeholder image of a protein
Icon representing a puzzle

1709: Revisiting Puzzle 63: Spinach Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This spinach protein is critical for photosynthesis, and participates in the electron transfer chain within the chloroplast. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AAYKVTLVTPTGNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKKEELTA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,200
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 11,167
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,125
  4. Avatar for Go Science 4. Go Science 36 pts. 11,118
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 24 pts. 11,076
  6. Avatar for Marvin's bunch 6. Marvin's bunch 16 pts. 11,073
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 11,029
  8. Avatar for Contenders 8. Contenders 6 pts. 10,990
  9. Avatar for HMT heritage 9. HMT heritage 4 pts. 10,989
  10. Avatar for Russian team 10. Russian team 2 pts. 10,855
  1. Avatar for boondog 101. boondog Lv 1 1 pt. 6,287
  2. Avatar for pioneer_round 102. pioneer_round Lv 1 1 pt. 6,197
  3. Avatar for Amsterdamaged 103. Amsterdamaged Lv 1 1 pt. 6,186
  4. Avatar for stephendl102 104. stephendl102 Lv 1 1 pt. 6,156
  5. Avatar for donuts554 105. donuts554 Lv 1 1 pt. 6,084
  6. Avatar for Ciccillo 106. Ciccillo Lv 1 1 pt. 6,001
  7. Avatar for sherryme 107. sherryme Lv 1 1 pt. 5,892
  8. Avatar for ikemori 108. ikemori Lv 1 1 pt. 4,889
  9. Avatar for xardasmat 109. xardasmat Lv 1 1 pt. 4,883
  10. Avatar for Alpha-KetoGlutarate1301 110. Alpha-KetoGlutarate1301 Lv 1 1 pt. 4,672

Comments