Placeholder image of a protein
Icon representing a puzzle

1712: Revisiting Puzzle 64: Thioredoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 11,505
  2. Avatar for The Daydreamers 12. The Daydreamers 1 pt. 11,462
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 11,313
  4. Avatar for Void Crushers 14. Void Crushers 1 pt. 10,972
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 10,791
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 11,765
  2. Avatar for NinjaGreg 2. NinjaGreg Lv 1 96 pts. 11,741
  3. Avatar for pvc78 3. pvc78 Lv 1 92 pts. 11,734
  4. Avatar for TastyMunchies 4. TastyMunchies Lv 1 88 pts. 11,719
  5. Avatar for Galaxie 5. Galaxie Lv 1 84 pts. 11,719
  6. Avatar for retiredmichael 6. retiredmichael Lv 1 80 pts. 11,717
  7. Avatar for jobo0502 7. jobo0502 Lv 1 77 pts. 11,704
  8. Avatar for nicobul 8. nicobul Lv 1 73 pts. 11,690
  9. Avatar for actiasluna 9. actiasluna Lv 1 70 pts. 11,678
  10. Avatar for Deleted player 10. Deleted player 67 pts. 11,666

Comments