Placeholder image of a protein
Icon representing a puzzle

1712: Revisiting Puzzle 64: Thioredoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,765
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,745
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 11,734
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 11,704
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 11,682
  6. Avatar for HMT heritage 6. HMT heritage 11 pts. 11,652
  7. Avatar for Contenders 7. Contenders 7 pts. 11,651
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 11,609
  9. Avatar for Russian team 9. Russian team 2 pts. 11,597
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 11,551
  1. Avatar for retiredmichael 11. retiredmichael Lv 1 2 pts. 11,669
  2. Avatar for alcor29 12. alcor29 Lv 1 1 pt. 11,660
  3. Avatar for phi16 13. phi16 Lv 1 1 pt. 11,656
  4. Avatar for fpc 14. fpc Lv 1 1 pt. 11,602
  5. Avatar for ReallyRatherDumb 15. ReallyRatherDumb Lv 1 1 pt. 11,582
  6. Avatar for NotJim99 16. NotJim99 Lv 1 1 pt. 11,574
  7. Avatar for jausmh 17. jausmh Lv 1 1 pt. 11,563
  8. Avatar for Willyanto 18. Willyanto Lv 1 1 pt. 11,440

Comments