Placeholder image of a protein
Icon representing a puzzle

1712: Revisiting Puzzle 64: Thioredoxin

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
August 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Go Science 100 pts. 11,765
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,745
  3. Avatar for Beta Folders 3. Beta Folders 47 pts. 11,734
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 11,704
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 11,682
  6. Avatar for HMT heritage 6. HMT heritage 11 pts. 11,652
  7. Avatar for Contenders 7. Contenders 7 pts. 11,651
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 11,609
  9. Avatar for Russian team 9. Russian team 2 pts. 11,597
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 11,551

  1. Avatar for whiteseb 101. whiteseb Lv 1 1 pt. 10,584
  2. Avatar for RockOn 102. RockOn Lv 1 1 pt. 10,332
  3. Avatar for Sydefecks 103. Sydefecks Lv 1 1 pt. 9,956
  4. Avatar for Alicates 104. Alicates Lv 1 1 pt. 9,845
  5. Avatar for Vincera 105. Vincera Lv 1 1 pt. 9,655
  6. Avatar for Therizinosaur 106. Therizinosaur Lv 1 1 pt. 9,511
  7. Avatar for Squirrely 107. Squirrely Lv 1 1 pt. 9,403
  8. Avatar for DipsyDoodle2016 108. DipsyDoodle2016 Lv 1 1 pt. 9,338
  9. Avatar for fosfotrinucleotide 109. fosfotrinucleotide Lv 1 1 pt. 7,955
  10. Avatar for Jiaying Huang 110. Jiaying Huang Lv 1 1 pt. 7,903

Comments