Placeholder image of a protein
Icon representing a puzzle

1716: Revisiting Puzzle 66: Cytochrome

Closed since over 6 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 19, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,128
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,106
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 9,972
  4. Avatar for Team South Africa 14. Team South Africa 1 pt. 9,351
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 9,231

  1. Avatar for RockOn
    1. RockOn Lv 1
    100 pts. 10,362
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 96 pts. 10,239
  3. Avatar for NinjaGreg 3. NinjaGreg Lv 1 92 pts. 10,224
  4. Avatar for Phyx 4. Phyx Lv 1 88 pts. 10,222
  5. Avatar for crpainter 5. crpainter Lv 1 84 pts. 10,219
  6. Avatar for LociOiling 6. LociOiling Lv 1 80 pts. 10,217
  7. Avatar for Galaxie 7. Galaxie Lv 1 77 pts. 10,214
  8. Avatar for retiredmichael 8. retiredmichael Lv 1 73 pts. 10,213
  9. Avatar for johnmitch 9. johnmitch Lv 1 70 pts. 10,212
  10. Avatar for Deleted player 10. Deleted player pts. 10,211

Comments