Placeholder image of a protein
Icon representing a puzzle

1716: Revisiting Puzzle 66: Cytochrome

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
August 19, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to transfer electrons between substrates in bacteria. The protein is modeled here in reducing conditions, and no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Top groups


  1. Avatar for Go Science 100 pts. 10,239
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,229
  3. Avatar for Contenders 3. Contenders 47 pts. 10,219
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 10,217
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 10,209
  6. Avatar for HMT heritage 6. HMT heritage 11 pts. 10,209
  7. Avatar for Gargleblasters 7. Gargleblasters 7 pts. 10,195
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 4 pts. 10,190
  9. Avatar for Void Crushers 9. Void Crushers 2 pts. 10,171
  10. Avatar for Russian team 10. Russian team 1 pt. 10,165

  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 10,238
  2. Avatar for silent gene 2. silent gene Lv 1 70 pts. 10,236
  3. Avatar for Galaxie 3. Galaxie Lv 1 47 pts. 10,229
  4. Avatar for LociOiling 4. LociOiling Lv 1 30 pts. 10,217
  5. Avatar for Deleted player 5. Deleted player 19 pts. 10,214
  6. Avatar for robgee 6. robgee Lv 1 11 pts. 10,214
  7. Avatar for Deleted player 7. Deleted player pts. 10,214
  8. Avatar for fpc 8. fpc Lv 1 4 pts. 10,209
  9. Avatar for phi16 9. phi16 Lv 1 2 pts. 10,197
  10. Avatar for alcor29 10. alcor29 Lv 1 1 pt. 10,195

Comments