Placeholder image of a protein
Icon representing a puzzle

1720: Revisiting Puzzle 67: Integrase

Closed since over 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
August 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,152
  2. Avatar for Russian team 12. Russian team 1 pt. 10,140
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,598

  1. Avatar for Aubade01
    1. Aubade01 Lv 1
    100 pts. 10,478
  2. Avatar for grogar7 2. grogar7 Lv 1 96 pts. 10,465
  3. Avatar for Galaxie 3. Galaxie Lv 1 92 pts. 10,461
  4. Avatar for Deleted player 4. Deleted player 87 pts. 10,459
  5. Avatar for LociOiling 5. LociOiling Lv 1 83 pts. 10,456
  6. Avatar for retiredmichael 6. retiredmichael Lv 1 79 pts. 10,438
  7. Avatar for Deleted player 7. Deleted player pts. 10,422
  8. Avatar for Threeoak 8. Threeoak Lv 1 72 pts. 10,421
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 69 pts. 10,406
  10. Avatar for johnmitch 10. johnmitch Lv 1 65 pts. 10,396

Comments