Placeholder image of a protein
Icon representing a puzzle

1720: Revisiting Puzzle 67: Integrase

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,152
  2. Avatar for Russian team 12. Russian team 1 pt. 10,140
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,598
  1. Avatar for Sydefecks 91. Sydefecks Lv 1 1 pt. 9,177
  2. Avatar for Belle36 92. Belle36 Lv 1 1 pt. 9,175
  3. Avatar for softbear 93. softbear Lv 1 1 pt. 9,150
  4. Avatar for Loickmoi 94. Loickmoi Lv 1 1 pt. 9,143
  5. Avatar for Willyanto 95. Willyanto Lv 1 1 pt. 9,140
  6. Avatar for FoldUp47 96. FoldUp47 Lv 1 1 pt. 9,107
  7. Avatar for elanarenay 97. elanarenay Lv 1 1 pt. 9,105
  8. Avatar for sarevok 98. sarevok Lv 1 1 pt. 9,051
  9. Avatar for GuyWithMustache 99. GuyWithMustache Lv 1 1 pt. 9,021
  10. Avatar for 00crashtest 100. 00crashtest Lv 1 1 pt. 9,007

Comments