Placeholder image of a protein
Icon representing a puzzle

1720: Revisiting Puzzle 67: Integrase

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,152
  2. Avatar for Russian team 12. Russian team 1 pt. 10,140
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,598
  1. Avatar for silent gene 21. silent gene Lv 1 36 pts. 10,293
  2. Avatar for TastyMunchies 22. TastyMunchies Lv 1 34 pts. 10,293
  3. Avatar for actiasluna 23. actiasluna Lv 1 33 pts. 10,281
  4. Avatar for dcrwheeler 24. dcrwheeler Lv 1 31 pts. 10,281
  5. Avatar for frood66 25. frood66 Lv 1 29 pts. 10,279
  6. Avatar for manu8170 26. manu8170 Lv 1 27 pts. 10,274
  7. Avatar for aznarog 27. aznarog Lv 1 26 pts. 10,257
  8. Avatar for guineapig 28. guineapig Lv 1 24 pts. 10,246
  9. Avatar for jobo0502 29. jobo0502 Lv 1 23 pts. 10,242
  10. Avatar for Norrjane 30. Norrjane Lv 1 21 pts. 10,242

Comments