Placeholder image of a protein
Icon representing a puzzle

1720: Revisiting Puzzle 67: Integrase

Closed since over 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
August 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,152
  2. Avatar for Russian team 12. Russian team 1 pt. 10,140
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,598
  1. Avatar for kitek314_pl 31. kitek314_pl Lv 1 20 pts. 10,217
  2. Avatar for gdnskye 32. gdnskye Lv 1 19 pts. 10,208
  3. Avatar for joremen 33. joremen Lv 1 18 pts. 10,197
  4. Avatar for christioanchauvin 34. christioanchauvin Lv 1 17 pts. 10,191
  5. Avatar for fpc 35. fpc Lv 1 16 pts. 10,188
  6. Avatar for georg137 36. georg137 Lv 1 15 pts. 10,183
  7. Avatar for vuvuvu 37. vuvuvu Lv 1 14 pts. 10,152
  8. Avatar for vakobo 38. vakobo Lv 1 13 pts. 10,140
  9. Avatar for diamonddays 39. diamonddays Lv 1 12 pts. 10,135
  10. Avatar for mberna00 40. mberna00 Lv 1 11 pts. 10,129

Comments