Placeholder image of a protein
Icon representing a puzzle

1720: Revisiting Puzzle 67: Integrase

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,152
  2. Avatar for Russian team 12. Russian team 1 pt. 10,140
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,598
  1. Avatar for Vinara 51. Vinara Lv 1 5 pts. 10,029
  2. Avatar for stomjoh 52. stomjoh Lv 1 5 pts. 10,018
  3. Avatar for martin.kendig@verizon.net 53. martin.kendig@verizon.net Lv 1 4 pts. 9,969
  4. Avatar for jausmh 54. jausmh Lv 1 4 pts. 9,967
  5. Avatar for Museka 55. Museka Lv 1 4 pts. 9,964
  6. Avatar for Pawel Tluscik 56. Pawel Tluscik Lv 1 3 pts. 9,933
  7. Avatar for heather-1 57. heather-1 Lv 1 3 pts. 9,928
  8. Avatar for pfirth 58. pfirth Lv 1 3 pts. 9,866
  9. Avatar for pvc78 59. pvc78 Lv 1 3 pts. 9,823
  10. Avatar for Hellcat6 60. Hellcat6 Lv 1 2 pts. 9,812

Comments