Placeholder image of a protein
Icon representing a puzzle

1720: Revisiting Puzzle 67: Integrase

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
August 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,152
  2. Avatar for Russian team 12. Russian team 1 pt. 10,140
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,598
  1. Avatar for dbuske 61. dbuske Lv 1 2 pts. 9,810
  2. Avatar for Glen B 62. Glen B Lv 1 2 pts. 9,799
  3. Avatar for gurch 63. gurch Lv 1 2 pts. 9,797
  4. Avatar for Keresto 64. Keresto Lv 1 2 pts. 9,784
  5. Avatar for kevin everington 65. kevin everington Lv 1 2 pts. 9,768
  6. Avatar for RockOn 66. RockOn Lv 1 2 pts. 9,735
  7. Avatar for navn 67. navn Lv 1 1 pt. 9,725
  8. Avatar for Merf 68. Merf Lv 1 1 pt. 9,715
  9. Avatar for rabamino12358 69. rabamino12358 Lv 1 1 pt. 9,690
  10. Avatar for yaoyy 70. yaoyy Lv 1 1 pt. 9,688

Comments