Placeholder image of a protein
Icon representing a puzzle

1724: Revisiting Puzzle 68: Bos Taurus

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 01, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,232
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,882
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,849
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,596
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 6,987
  1. Avatar for lamoille 101. lamoille Lv 1 1 pt. 8,952
  2. Avatar for Jiaying Huang 102. Jiaying Huang Lv 1 1 pt. 8,927
  3. Avatar for jamiexq 103. jamiexq Lv 1 1 pt. 8,909
  4. Avatar for momadoc 104. momadoc Lv 1 1 pt. 8,852
  5. Avatar for fosfotrinucleotide 105. fosfotrinucleotide Lv 1 1 pt. 8,732
  6. Avatar for aliciardg123 106. aliciardg123 Lv 1 1 pt. 8,629
  7. Avatar for kubek915 107. kubek915 Lv 1 1 pt. 8,306
  8. Avatar for 01010011111 108. 01010011111 Lv 1 1 pt. 8,022
  9. Avatar for pateldhruvi525 109. pateldhruvi525 Lv 1 1 pt. 7,907
  10. Avatar for Puttering 110. Puttering Lv 1 1 pt. 7,483

Comments