Placeholder image of a protein
Icon representing a puzzle

1724: Revisiting Puzzle 68: Bos Taurus

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 01, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,232
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,882
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,849
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,596
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 6,987
  1. Avatar for Idiotboy 111. Idiotboy Lv 1 1 pt. 7,176
  2. Avatar for Aminal88 112. Aminal88 Lv 1 1 pt. 6,987
  3. Avatar for Aquafiltered420 113. Aquafiltered420 Lv 1 1 pt. 6,115
  4. Avatar for Rus 114. Rus Lv 1 1 pt. 5,559
  5. Avatar for mberna00 115. mberna00 Lv 1 1 pt. 4,858
  6. Avatar for Hollinas 116. Hollinas Lv 1 1 pt. 4,858
  7. Avatar for bkoep 117. bkoep Lv 1 1 pt. 4,858
  8. Avatar for rmoretti 118. rmoretti Lv 1 1 pt. 4,858

Comments