Placeholder image of a protein
Icon representing a puzzle

1724: Revisiting Puzzle 68: Bos Taurus

Closed since over 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
September 01, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,232
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,882
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,849
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,596
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 6,987
  1. Avatar for fiendish_ghoul 11. fiendish_ghoul Lv 1 64 pts. 10,562
  2. Avatar for crpainter 12. crpainter Lv 1 62 pts. 10,561
  3. Avatar for carsonfb 13. carsonfb Lv 1 59 pts. 10,556
  4. Avatar for grogar7 14. grogar7 Lv 1 56 pts. 10,537
  5. Avatar for robgee 15. robgee Lv 1 53 pts. 10,536
  6. Avatar for anthion 16. anthion Lv 1 51 pts. 10,532
  7. Avatar for actiasluna 17. actiasluna Lv 1 48 pts. 10,529
  8. Avatar for phi16 18. phi16 Lv 1 46 pts. 10,528
  9. Avatar for christioanchauvin 19. christioanchauvin Lv 1 44 pts. 10,525
  10. Avatar for Phyx 20. Phyx Lv 1 42 pts. 10,525

Comments