Placeholder image of a protein
Icon representing a puzzle

1724: Revisiting Puzzle 68: Bos Taurus

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 01, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,232
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,882
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,849
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,596
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 6,987
  1. Avatar for Vincera 61. Vincera Lv 1 3 pts. 9,932
  2. Avatar for Hellcat6 62. Hellcat6 Lv 1 3 pts. 9,920
  3. Avatar for Alistair69 63. Alistair69 Lv 1 3 pts. 9,917
  4. Avatar for pfirth 64. pfirth Lv 1 3 pts. 9,909
  5. Avatar for neon_fuzz 65. neon_fuzz Lv 1 2 pts. 9,908
  6. Avatar for hada 66. hada Lv 1 2 pts. 9,902
  7. Avatar for boondog 67. boondog Lv 1 2 pts. 9,900
  8. Avatar for rezaefar 68. rezaefar Lv 1 2 pts. 9,898
  9. Avatar for cinnamonkitty 69. cinnamonkitty Lv 1 2 pts. 9,896
  10. Avatar for drumpeter18yrs9yrs 70. drumpeter18yrs9yrs Lv 1 2 pts. 9,892

Comments