Placeholder image of a protein
Icon representing a puzzle

1724: Revisiting Puzzle 68: Bos Taurus

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
September 01, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 10,232
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,882
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,849
  4. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 6,987

  1. Avatar for ManVsYard 81. ManVsYard Lv 1 1 pt. 9,655
  2. Avatar for rabamino12358 82. rabamino12358 Lv 1 1 pt. 9,629
  3. Avatar for kevin everington 83. kevin everington Lv 1 1 pt. 9,625
  4. Avatar for nathanmills 84. nathanmills Lv 1 1 pt. 9,596
  5. Avatar for pandapharmd 85. pandapharmd Lv 1 1 pt. 9,561
  6. Avatar for west.elsdon 86. west.elsdon Lv 1 1 pt. 9,503
  7. Avatar for navn 87. navn Lv 1 1 pt. 9,487
  8. Avatar for sarevok 88. sarevok Lv 1 1 pt. 9,457
  9. Avatar for harvardman 89. harvardman Lv 1 1 pt. 9,430
  10. Avatar for Auntecedent 90. Auntecedent Lv 1 1 pt. 9,422

Comments