Placeholder image of a protein
Icon representing a puzzle

1727: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 10,004
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,516
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,315
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,066
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,854
  6. Avatar for Gioca con la scienza 16. Gioca con la scienza 1 pt. 3,025
  1. Avatar for martinzblavy 101. martinzblavy Lv 1 1 pt. 8,736
  2. Avatar for abiogenesis 102. abiogenesis Lv 1 1 pt. 8,707
  3. Avatar for lamoille 103. lamoille Lv 1 1 pt. 8,701
  4. Avatar for stuckemr 104. stuckemr Lv 1 1 pt. 8,695
  5. Avatar for sofiathebass 105. sofiathebass Lv 1 1 pt. 8,637
  6. Avatar for kei01173 106. kei01173 Lv 1 1 pt. 8,617
  7. Avatar for hl6hc 107. hl6hc Lv 1 1 pt. 8,615
  8. Avatar for bob 108. bob Lv 1 1 pt. 8,603
  9. Avatar for poiuy 109. poiuy Lv 1 1 pt. 8,564
  10. Avatar for cbwest 110. cbwest Lv 1 1 pt. 8,559

Comments