Placeholder image of a protein
Icon representing a puzzle

1727: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 10,004
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,516
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,315
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,066
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,854
  6. Avatar for Gioca con la scienza 16. Gioca con la scienza 1 pt. 3,025
  1. Avatar for Anfinsen_slept_here 21. Anfinsen_slept_here Lv 1 41 pts. 10,537
  2. Avatar for dcrwheeler 22. dcrwheeler Lv 1 39 pts. 10,537
  3. Avatar for grogar7 23. grogar7 Lv 1 37 pts. 10,536
  4. Avatar for jobo0502 24. jobo0502 Lv 1 35 pts. 10,506
  5. Avatar for Blipperman 25. Blipperman Lv 1 33 pts. 10,498
  6. Avatar for Deleted player 26. Deleted player 32 pts. 10,470
  7. Avatar for guineapig 27. guineapig Lv 1 30 pts. 10,455
  8. Avatar for vakobo 28. vakobo Lv 1 28 pts. 10,443
  9. Avatar for mberna00 29. mberna00 Lv 1 27 pts. 10,440
  10. Avatar for joremen 30. joremen Lv 1 26 pts. 10,439

Comments