Placeholder image of a protein
Icon representing a puzzle

1727: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
September 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups


  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 10,004
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,516
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,315
  4. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,854
  5. Avatar for Gioca con la scienza 16. Gioca con la scienza 1 pt. 3,025

  1. Avatar for christioanchauvin 31. christioanchauvin Lv 1 24 pts. 10,436
  2. Avatar for drumpeter18yrs9yrs 32. drumpeter18yrs9yrs Lv 1 23 pts. 10,423
  3. Avatar for phi16 33. phi16 Lv 1 22 pts. 10,415
  4. Avatar for jamiexq 34. jamiexq Lv 1 21 pts. 10,406
  5. Avatar for WBarme1234 35. WBarme1234 Lv 1 19 pts. 10,403
  6. Avatar for pvc78 36. pvc78 Lv 1 18 pts. 10,356
  7. Avatar for MicElephant 37. MicElephant Lv 1 17 pts. 10,315
  8. Avatar for Threeoak 38. Threeoak Lv 1 16 pts. 10,307
  9. Avatar for Vinara 39. Vinara Lv 1 15 pts. 10,297
  10. Avatar for neon_fuzz 40. neon_fuzz Lv 1 15 pts. 10,247

Comments