Placeholder image of a protein
Icon representing a puzzle

1727: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 10,004
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,516
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,315
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,066
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,854
  6. Avatar for Gioca con la scienza 16. Gioca con la scienza 1 pt. 3,025
  1. Avatar for jausmh 51. jausmh Lv 1 7 pts. 9,980
  2. Avatar for RockOn 52. RockOn Lv 1 7 pts. 9,844
  3. Avatar for orily1337 53. orily1337 Lv 1 6 pts. 9,836
  4. Avatar for Merf 54. Merf Lv 1 6 pts. 9,775
  5. Avatar for Silvercraft 55. Silvercraft Lv 1 6 pts. 9,701
  6. Avatar for alcor29 56. alcor29 Lv 1 5 pts. 9,695
  7. Avatar for Vincera 57. Vincera Lv 1 5 pts. 9,656
  8. Avatar for Pawel Tluscik 58. Pawel Tluscik Lv 1 4 pts. 9,630
  9. Avatar for rezaefar 59. rezaefar Lv 1 4 pts. 9,605
  10. Avatar for kevin everington 60. kevin everington Lv 1 4 pts. 9,553

Comments