Placeholder image of a protein
Icon representing a puzzle

1727: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 10,004
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,516
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,315
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,066
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,854
  6. Avatar for Gioca con la scienza 16. Gioca con la scienza 1 pt. 3,025
  1. Avatar for PeterDav 61. PeterDav Lv 1 4 pts. 9,549
  2. Avatar for Alistair69 62. Alistair69 Lv 1 3 pts. 9,527
  3. Avatar for JasperD 63. JasperD Lv 1 3 pts. 9,516
  4. Avatar for rabamino12358 64. rabamino12358 Lv 1 3 pts. 9,495
  5. Avatar for Altercomp 65. Altercomp Lv 1 3 pts. 9,490
  6. Avatar for Squirrely 66. Squirrely Lv 1 3 pts. 9,467
  7. Avatar for xbp 67. xbp Lv 1 2 pts. 9,374
  8. Avatar for dd-2 68. dd-2 Lv 1 2 pts. 9,365
  9. Avatar for zgf2022 69. zgf2022 Lv 1 2 pts. 9,363
  10. Avatar for harvardman 70. harvardman Lv 1 2 pts. 9,362

Comments