Placeholder image of a protein
Icon representing a puzzle

1727: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 10,004
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,516
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,315
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,066
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,854
  6. Avatar for Gioca con la scienza 16. Gioca con la scienza 1 pt. 3,025
  1. Avatar for kitek314_pl 71. kitek314_pl Lv 1 2 pts. 9,315
  2. Avatar for navn 72. navn Lv 1 2 pts. 9,313
  3. Avatar for cobaltteal 73. cobaltteal Lv 1 2 pts. 9,276
  4. Avatar for diamonddays 74. diamonddays Lv 1 1 pt. 9,274
  5. Avatar for rinze 75. rinze Lv 1 1 pt. 9,259
  6. Avatar for martin.kendig@verizon.net 76. martin.kendig@verizon.net Lv 1 1 pt. 9,200
  7. Avatar for Arne Heessels 77. Arne Heessels Lv 1 1 pt. 9,200
  8. Avatar for dbuske 78. dbuske Lv 1 1 pt. 9,191
  9. Avatar for pfirth 79. pfirth Lv 1 1 pt. 9,189
  10. Avatar for ti_go_Mars 80. ti_go_Mars Lv 1 1 pt. 9,172

Comments