Placeholder image of a protein
Icon representing a puzzle

1727: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Kotocycle 11. Kotocycle 1 pt. 10,004
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,516
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,315
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 9,066
  5. Avatar for Trinity Biology 15. Trinity Biology 1 pt. 8,854
  6. Avatar for Gioca con la scienza 16. Gioca con la scienza 1 pt. 3,025
  1. Avatar for DAMilwaukeeWisconsin 81. DAMilwaukeeWisconsin Lv 1 1 pt. 9,126
  2. Avatar for dahast.de 82. dahast.de Lv 1 1 pt. 9,109
  3. Avatar for porrengia 83. porrengia Lv 1 1 pt. 9,080
  4. Avatar for nathanmills 84. nathanmills Lv 1 1 pt. 9,066
  5. Avatar for Noosfera 85. Noosfera Lv 1 1 pt. 9,036
  6. Avatar for martinf 86. martinf Lv 1 1 pt. 9,035
  7. Avatar for Deimeter 87. Deimeter Lv 1 1 pt. 9,035
  8. Avatar for Willyanto 88. Willyanto Lv 1 1 pt. 9,027
  9. Avatar for hada 89. hada Lv 1 1 pt. 9,004
  10. Avatar for multaq 90. multaq Lv 1 1 pt. 8,970

Comments