Placeholder image of a protein
Icon representing a puzzle

1727: Revisiting Puzzle 69: Scorpion Toxin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI

Top groups

  1. Avatar for Marvin's bunch
    1. Marvin's bunch
    100 pts. 10,992
  2. Avatar for Beta Folders 2. Beta Folders 71 pts. 10,989
  3. Avatar for Void Crushers 3. Void Crushers 49 pts. 10,916
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 10,806
  5. Avatar for HMT heritage 5. HMT heritage 22 pts. 10,791
  6. Avatar for Go Science 6. Go Science 14 pts. 10,742
  7. Avatar for Contenders 7. Contenders 8 pts. 10,686
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,667
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 3 pts. 10,649
  10. Avatar for Russian team 10. Russian team 2 pts. 10,443
  1. Avatar for Idiotboy 11. Idiotboy Lv 1 65 pts. 10,697
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 62 pts. 10,687
  3. Avatar for crpainter 13. crpainter Lv 1 60 pts. 10,686
  4. Avatar for Galaxie 14. Galaxie Lv 1 57 pts. 10,683
  5. Avatar for Phyx 15. Phyx Lv 1 54 pts. 10,673
  6. Avatar for Deleted player 16. Deleted player pts. 10,673
  7. Avatar for anthion 17. anthion Lv 1 49 pts. 10,667
  8. Avatar for aznarog 18. aznarog Lv 1 47 pts. 10,649
  9. Avatar for silent gene 19. silent gene Lv 1 45 pts. 10,623
  10. Avatar for georg137 20. georg137 Lv 1 43 pts. 10,554

Comments