Placeholder image of a protein
Icon representing a puzzle

1731: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 3 pts. 10,444
  2. Avatar for Gargleblasters 12. Gargleblasters 2 pts. 10,434
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 10,156
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 10,063
  5. Avatar for Kotocycle 15. Kotocycle 1 pt. 10,026
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,917
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 9,904
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 9,863
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 9,473
  10. Avatar for Team Schleswig-Holstein 20. Team Schleswig-Holstein 1 pt. 9,448
  1. Avatar for silent gene
    1. silent gene Lv 1
    100 pts. 10,879
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 73 pts. 10,868
  3. Avatar for NinjaGreg 3. NinjaGreg Lv 1 52 pts. 10,852
  4. Avatar for gdnskye 4. gdnskye Lv 1 36 pts. 10,851
  5. Avatar for Galaxie 5. Galaxie Lv 1 24 pts. 10,845
  6. Avatar for LociOiling 6. LociOiling Lv 1 16 pts. 10,843
  7. Avatar for Deleted player 7. Deleted player 10 pts. 10,843
  8. Avatar for Deleted player 8. Deleted player pts. 10,837
  9. Avatar for ZeroLeak7 9. ZeroLeak7 Lv 1 4 pts. 10,826
  10. Avatar for lamoille 10. lamoille Lv 1 2 pts. 10,819

Comments