Placeholder image of a protein
Icon representing a puzzle

1731: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 3 pts. 10,444
  2. Avatar for Gargleblasters 12. Gargleblasters 2 pts. 10,434
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 10,156
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 10,063
  5. Avatar for Kotocycle 15. Kotocycle 1 pt. 10,026
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,917
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 9,904
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 9,863
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 9,473
  10. Avatar for Team Schleswig-Holstein 20. Team Schleswig-Holstein 1 pt. 9,448
  1. Avatar for Astralist 91. Astralist Lv 1 1 pt. 9,773
  2. Avatar for Anamfija 92. Anamfija Lv 1 1 pt. 9,767
  3. Avatar for fosfotrinucleotide 93. fosfotrinucleotide Lv 1 1 pt. 9,740
  4. Avatar for MMgpACT 94. MMgpACT Lv 1 1 pt. 9,730
  5. Avatar for gavingavin 95. gavingavin Lv 1 1 pt. 9,661
  6. Avatar for whitedune 96. whitedune Lv 1 1 pt. 9,656
  7. Avatar for mattyg2009 97. mattyg2009 Lv 1 1 pt. 9,651
  8. Avatar for Crystalepicness 98. Crystalepicness Lv 1 1 pt. 9,601
  9. Avatar for aaronbell 99. aaronbell Lv 1 1 pt. 9,597
  10. Avatar for gina.gina 100. gina.gina Lv 1 1 pt. 9,589

Comments