Placeholder image of a protein
Icon representing a puzzle

1731: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
September 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 3 pts. 10,444
  2. Avatar for Gargleblasters 12. Gargleblasters 2 pts. 10,434
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 10,156
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 10,063
  5. Avatar for Kotocycle 15. Kotocycle 1 pt. 10,026
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,917
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 9,904
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 9,863
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 9,473
  10. Avatar for Team Schleswig-Holstein 20. Team Schleswig-Holstein 1 pt. 9,448
  1. Avatar for multaq 101. multaq Lv 1 1 pt. 9,553
  2. Avatar for Fowardint 102. Fowardint Lv 1 1 pt. 9,551
  3. Avatar for Deleted player 103. Deleted player 1 pt. 9,547
  4. Avatar for leannerikicheever 104. leannerikicheever Lv 1 1 pt. 9,543
  5. Avatar for jb3 105. jb3 Lv 1 1 pt. 9,533
  6. Avatar for dd-2 106. dd-2 Lv 1 1 pt. 9,494
  7. Avatar for mrfu 107. mrfu Lv 1 1 pt. 9,473
  8. Avatar for Bithalbierer 108. Bithalbierer Lv 1 1 pt. 9,448
  9. Avatar for sarevok 109. sarevok Lv 1 1 pt. 9,447
  10. Avatar for Robo909 110. Robo909 Lv 1 1 pt. 9,405

Comments