Placeholder image of a protein
Icon representing a puzzle

1731: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 3 pts. 10,444
  2. Avatar for Gargleblasters 12. Gargleblasters 2 pts. 10,434
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 10,156
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 10,063
  5. Avatar for Kotocycle 15. Kotocycle 1 pt. 10,026
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,917
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 9,904
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 9,863
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 9,473
  10. Avatar for Team Schleswig-Holstein 20. Team Schleswig-Holstein 1 pt. 9,448
  1. Avatar for crpainter 11. crpainter Lv 1 64 pts. 10,736
  2. Avatar for jausmh 12. jausmh Lv 1 62 pts. 10,704
  3. Avatar for aznarog 13. aznarog Lv 1 59 pts. 10,694
  4. Avatar for vakobo 14. vakobo Lv 1 56 pts. 10,692
  5. Avatar for Galaxie 15. Galaxie Lv 1 53 pts. 10,690
  6. Avatar for LociOiling 16. LociOiling Lv 1 51 pts. 10,684
  7. Avatar for fiendish_ghoul 17. fiendish_ghoul Lv 1 48 pts. 10,675
  8. Avatar for Threeoak 18. Threeoak Lv 1 46 pts. 10,670
  9. Avatar for hpaege 19. hpaege Lv 1 44 pts. 10,626
  10. Avatar for silent gene 20. silent gene Lv 1 42 pts. 10,625

Comments