Placeholder image of a protein
Icon representing a puzzle

1731: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 3 pts. 10,444
  2. Avatar for Gargleblasters 12. Gargleblasters 2 pts. 10,434
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 10,156
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 10,063
  5. Avatar for Kotocycle 15. Kotocycle 1 pt. 10,026
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 9,917
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 9,904
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 9,863
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 9,473
  10. Avatar for Team Schleswig-Holstein 20. Team Schleswig-Holstein 1 pt. 9,448
  1. Avatar for fpc 51. fpc Lv 1 7 pts. 10,273
  2. Avatar for ralan-nsk 52. ralan-nsk Lv 1 6 pts. 10,268
  3. Avatar for 181818 53. 181818 Lv 1 6 pts. 10,265
  4. Avatar for Louis_LIB 54. Louis_LIB Lv 1 5 pts. 10,241
  5. Avatar for gurch 55. gurch Lv 1 5 pts. 10,238
  6. Avatar for Blipperman 56. Blipperman Lv 1 5 pts. 10,224
  7. Avatar for heather-1 57. heather-1 Lv 1 4 pts. 10,217
  8. Avatar for harvardman 58. harvardman Lv 1 4 pts. 10,216
  9. Avatar for Hellcat6 59. Hellcat6 Lv 1 4 pts. 10,213
  10. Avatar for dbuske 60. dbuske Lv 1 3 pts. 10,209

Comments