Placeholder image of a protein
Icon representing a puzzle

1735: Revisiting Puzzle 71: Crystallin

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
September 21, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Czech National Team 11. Czech National Team 3 pts. 10,733
  2. Avatar for Gargleblasters 12. Gargleblasters 2 pts. 10,704
  3. Avatar for Kotocycle 13. Kotocycle 1 pt. 10,372
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 10,333
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 10,312
  6. Avatar for Team New Zealand 16. Team New Zealand 1 pt. 10,222
  7. Avatar for The Daydreamers 17. The Daydreamers 1 pt. 10,131
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 9,763
  9. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,983

  1. Avatar for harvardman 91. harvardman Lv 1 1 pt. 9,926
  2. Avatar for Arne Heessels 92. Arne Heessels Lv 1 1 pt. 9,911
  3. Avatar for rinze 93. rinze Lv 1 1 pt. 9,819
  4. Avatar for sarevok 94. sarevok Lv 1 1 pt. 9,797
  5. Avatar for sulra001 95. sulra001 Lv 1 1 pt. 9,791
  6. Avatar for alyssa_d_V2.0 96. alyssa_d_V2.0 Lv 1 1 pt. 9,763
  7. Avatar for Louis_LIB 97. Louis_LIB Lv 1 1 pt. 9,763
  8. Avatar for pfirth 98. pfirth Lv 1 1 pt. 9,716
  9. Avatar for abiogenesis 99. abiogenesis Lv 1 1 pt. 9,681
  10. Avatar for CaptainCupcake 100. CaptainCupcake Lv 1 1 pt. 9,679

Comments