Placeholder image of a protein
Icon representing a puzzle

1735: Revisiting Puzzle 71: Crystallin

Closed since over 6 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 21, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Czech National Team 11. Czech National Team 3 pts. 10,733
  2. Avatar for Gargleblasters 12. Gargleblasters 2 pts. 10,704
  3. Avatar for Kotocycle 13. Kotocycle 1 pt. 10,372
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 10,333
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 10,312
  6. Avatar for Team New Zealand 16. Team New Zealand 1 pt. 10,222
  7. Avatar for The Daydreamers 17. The Daydreamers 1 pt. 10,131
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 9,763
  9. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,983

  1. Avatar for manu8170 41. manu8170 Lv 1 17 pts. 10,652
  2. Avatar for hansvandenhof 42. hansvandenhof Lv 1 16 pts. 10,643
  3. Avatar for aznarog 43. aznarog Lv 1 15 pts. 10,595
  4. Avatar for Blipperman 44. Blipperman Lv 1 14 pts. 10,593
  5. Avatar for WBarme1234 45. WBarme1234 Lv 1 14 pts. 10,588
  6. Avatar for Museka 46. Museka Lv 1 13 pts. 10,583
  7. Avatar for silent gene 47. silent gene Lv 1 12 pts. 10,580
  8. Avatar for diamonddays 48. diamonddays Lv 1 12 pts. 10,580
  9. Avatar for roman madala 49. roman madala Lv 1 11 pts. 10,571
  10. Avatar for 181818 50. 181818 Lv 1 10 pts. 10,540

Comments