Placeholder image of a protein
Icon representing a puzzle

1735: Revisiting Puzzle 71: Crystallin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 21, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 3 pts. 10,733
  2. Avatar for Gargleblasters 12. Gargleblasters 2 pts. 10,704
  3. Avatar for Kotocycle 13. Kotocycle 1 pt. 10,372
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 10,333
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 10,312
  6. Avatar for Team New Zealand 16. Team New Zealand 1 pt. 10,222
  7. Avatar for The Daydreamers 17. The Daydreamers 1 pt. 10,131
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 9,763
  9. Avatar for Rice Biochemistry 301 2020_2021 19. Rice Biochemistry 301 2020_2021 1 pt. 7,257
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,983
  1. Avatar for ManVsYard 71. ManVsYard Lv 1 3 pts. 10,345
  2. Avatar for vuvuvu 72. vuvuvu Lv 1 3 pts. 10,333
  3. Avatar for rabamino12358 73. rabamino12358 Lv 1 2 pts. 10,324
  4. Avatar for kitek314_pl 74. kitek314_pl Lv 1 2 pts. 10,312
  5. Avatar for gurch 75. gurch Lv 1 2 pts. 10,302
  6. Avatar for detectorist 76. detectorist Lv 1 2 pts. 10,231
  7. Avatar for NewZealand 77. NewZealand Lv 1 2 pts. 10,222
  8. Avatar for fpc 78. fpc Lv 1 2 pts. 10,222
  9. Avatar for NotJim99 79. NotJim99 Lv 1 2 pts. 10,219
  10. Avatar for RotterdamScience 80. RotterdamScience Lv 1 2 pts. 10,218

Comments