Placeholder image of a protein
Icon representing a puzzle

1735: Revisiting Puzzle 71: Crystallin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 21, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for Czech National Team 11. Czech National Team 3 pts. 10,733
  2. Avatar for Gargleblasters 12. Gargleblasters 2 pts. 10,704
  3. Avatar for Kotocycle 13. Kotocycle 1 pt. 10,372
  4. Avatar for Italiani Al Lavoro 14. Italiani Al Lavoro 1 pt. 10,333
  5. Avatar for BOINC@Poland 15. BOINC@Poland 1 pt. 10,312
  6. Avatar for Team New Zealand 16. Team New Zealand 1 pt. 10,222
  7. Avatar for The Daydreamers 17. The Daydreamers 1 pt. 10,131
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 9,763
  9. Avatar for Rice Biochemistry 301 2020_2021 19. Rice Biochemistry 301 2020_2021 1 pt. 7,257
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,983
  1. Avatar for Cloudy101 81. Cloudy101 Lv 1 1 pt. 10,131
  2. Avatar for sharondipity 82. sharondipity Lv 1 1 pt. 10,072
  3. Avatar for TurtleByte 83. TurtleByte Lv 1 1 pt. 10,067
  4. Avatar for andromeda72 84. andromeda72 Lv 1 1 pt. 10,031
  5. Avatar for whitedune 85. whitedune Lv 1 1 pt. 10,026
  6. Avatar for dbuske 86. dbuske Lv 1 1 pt. 10,009
  7. Avatar for xbp 87. xbp Lv 1 1 pt. 9,994
  8. Avatar for Auntecedent 88. Auntecedent Lv 1 1 pt. 9,962
  9. Avatar for kevin everington 89. kevin everington Lv 1 1 pt. 9,937
  10. Avatar for Anfinsen_slept_here 90. Anfinsen_slept_here Lv 1 1 pt. 9,927

Comments