Placeholder image of a protein
Icon representing a puzzle

1735: Revisiting Puzzle 71: Crystallin

Closed since over 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
September 21, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,265
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 11,249
  3. Avatar for Go Science 3. Go Science 58 pts. 11,228
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 11,060
  5. Avatar for HMT heritage 5. HMT heritage 31 pts. 11,056
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 11,052
  7. Avatar for Marvin's bunch 7. Marvin's bunch 15 pts. 11,032
  8. Avatar for Russian team 8. Russian team 11 pts. 10,990
  9. Avatar for Contenders 9. Contenders 7 pts. 10,980
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 5 pts. 10,738

  1. Avatar for crpainter 21. crpainter Lv 1 44 pts. 10,980
  2. Avatar for jobo0502 22. jobo0502 Lv 1 43 pts. 10,965
  3. Avatar for Alistair69 23. Alistair69 Lv 1 41 pts. 10,960
  4. Avatar for drumpeter18yrs9yrs 24. drumpeter18yrs9yrs Lv 1 39 pts. 10,958
  5. Avatar for cbwest 25. cbwest Lv 1 37 pts. 10,928
  6. Avatar for Glen B 26. Glen B Lv 1 35 pts. 10,922
  7. Avatar for jausmh 27. jausmh Lv 1 34 pts. 10,907
  8. Avatar for georg137 28. georg137 Lv 1 32 pts. 10,903
  9. Avatar for alcor29 29. alcor29 Lv 1 31 pts. 10,900
  10. Avatar for NinjaGreg 30. NinjaGreg Lv 1 29 pts. 10,872

Comments