Placeholder image of a protein
Icon representing a puzzle

1735: Revisiting Puzzle 71: Crystallin

Closed since over 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
September 21, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,265
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 11,249
  3. Avatar for Go Science 3. Go Science 58 pts. 11,228
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 11,060
  5. Avatar for HMT heritage 5. HMT heritage 31 pts. 11,056
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 11,052
  7. Avatar for Marvin's bunch 7. Marvin's bunch 15 pts. 11,032
  8. Avatar for Russian team 8. Russian team 11 pts. 10,990
  9. Avatar for Contenders 9. Contenders 7 pts. 10,980
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 5 pts. 10,738

  1. Avatar for pvc78 31. pvc78 Lv 1 28 pts. 10,828
  2. Avatar for nicobul 32. nicobul Lv 1 27 pts. 10,828
  3. Avatar for rezaefar 33. rezaefar Lv 1 25 pts. 10,800
  4. Avatar for fiendish_ghoul 34. fiendish_ghoul Lv 1 24 pts. 10,774
  5. Avatar for Idiotboy 35. Idiotboy Lv 1 23 pts. 10,756
  6. Avatar for JasperD 36. JasperD Lv 1 22 pts. 10,738
  7. Avatar for Biosphere 37. Biosphere Lv 1 21 pts. 10,733
  8. Avatar for anthion 38. anthion Lv 1 20 pts. 10,704
  9. Avatar for neon_fuzz 39. neon_fuzz Lv 1 19 pts. 10,704
  10. Avatar for Silvercraft 40. Silvercraft Lv 1 18 pts. 10,686

Comments