Placeholder image of a protein
Icon representing a puzzle

1735: Revisiting Puzzle 71: Crystallin

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 21, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,265
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 11,249
  3. Avatar for Go Science 3. Go Science 58 pts. 11,228
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 11,060
  5. Avatar for HMT heritage 5. HMT heritage 31 pts. 11,056
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 11,052
  7. Avatar for Marvin's bunch 7. Marvin's bunch 15 pts. 11,032
  8. Avatar for Russian team 8. Russian team 11 pts. 10,990
  9. Avatar for Contenders 9. Contenders 7 pts. 10,980
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 5 pts. 10,738
  1. Avatar for bkoep 121. bkoep Lv 1 1 pt. 9,150
  2. Avatar for Simek 122. Simek Lv 1 1 pt. 8,792
  3. Avatar for Ginger_RS 123. Ginger_RS Lv 1 1 pt. 8,785
  4. Avatar for Squirrely 124. Squirrely Lv 1 1 pt. 8,654
  5. Avatar for 01010011111 125. 01010011111 Lv 1 1 pt. 8,461
  6. Avatar for Puttering 126. Puttering Lv 1 1 pt. 8,383
  7. Avatar for OlleFolderMaster 127. OlleFolderMaster Lv 1 1 pt. 8,138
  8. Avatar for SkandanA 128. SkandanA Lv 1 1 pt. 7,257
  9. Avatar for C o n s u m e 129. C o n s u m e Lv 1 1 pt. 6,987
  10. Avatar for doctaven 130. doctaven Lv 1 1 pt. 6,983

Comments