Placeholder image of a protein
Icon representing a puzzle

1743: Revisiting Puzzle 73: Polycystein

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
October 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,972
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,894
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 9,258
  4. Avatar for bioinforockers 14. bioinforockers 1 pt. 8,470
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 8,411

  1. Avatar for ZeroLeak7
    1. ZeroLeak7 Lv 1
    100 pts. 10,709
  2. Avatar for silent gene 2. silent gene Lv 1 80 pts. 10,702
  3. Avatar for Anfinsen_slept_here 3. Anfinsen_slept_here Lv 1 63 pts. 10,702
  4. Avatar for LociOiling 4. LociOiling Lv 1 49 pts. 10,702
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 37 pts. 10,699
  6. Avatar for Deleted player 6. Deleted player 28 pts. 10,695
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 21 pts. 10,689
  8. Avatar for Phyx 8. Phyx Lv 1 15 pts. 10,681
  9. Avatar for Hollinas 9. Hollinas Lv 1 11 pts. 10,636
  10. Avatar for dbuske 10. dbuske Lv 1 8 pts. 10,545

Comments