Placeholder image of a protein
Icon representing a puzzle

1743: Revisiting Puzzle 73: Polycystein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
October 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,972
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,894
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 9,258
  4. Avatar for bioinforockers 14. bioinforockers 1 pt. 8,470
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 8,411
  1. Avatar for fiendish_ghoul 11. fiendish_ghoul Lv 1 66 pts. 10,407
  2. Avatar for NinjaGreg 12. NinjaGreg Lv 1 64 pts. 10,401
  3. Avatar for robgee 13. robgee Lv 1 61 pts. 10,397
  4. Avatar for grogar7 14. grogar7 Lv 1 58 pts. 10,376
  5. Avatar for dcrwheeler 15. dcrwheeler Lv 1 56 pts. 10,347
  6. Avatar for silent gene 16. silent gene Lv 1 53 pts. 10,345
  7. Avatar for nicobul 17. nicobul Lv 1 51 pts. 10,313
  8. Avatar for christioanchauvin 18. christioanchauvin Lv 1 49 pts. 10,306
  9. Avatar for O Seki To 19. O Seki To Lv 1 46 pts. 10,305
  10. Avatar for Galaxie 20. Galaxie Lv 1 44 pts. 10,262

Comments