Placeholder image of a protein
Icon representing a puzzle

1743: Revisiting Puzzle 73: Polycystein

Closed since over 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,972
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,894
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 1 pt. 9,258
  4. Avatar for bioinforockers 14. bioinforockers 1 pt. 8,470
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 8,411

  1. Avatar for RockOn 41. RockOn Lv 1 15 pts. 9,940
  2. Avatar for Norrjane 42. Norrjane Lv 1 14 pts. 9,927
  3. Avatar for JasperD 43. JasperD Lv 1 13 pts. 9,894
  4. Avatar for DoctorSockrates 44. DoctorSockrates Lv 1 13 pts. 9,886
  5. Avatar for pvc78 45. pvc78 Lv 1 12 pts. 9,844
  6. Avatar for heather-1 46. heather-1 Lv 1 11 pts. 9,812
  7. Avatar for hada 47. hada Lv 1 11 pts. 9,806
  8. Avatar for 181818 48. 181818 Lv 1 10 pts. 9,800
  9. Avatar for jamiexq 49. jamiexq Lv 1 9 pts. 9,724
  10. Avatar for neon_fuzz 50. neon_fuzz Lv 1 9 pts. 9,704

Comments