Placeholder image of a protein
Icon representing a puzzle

1743: Revisiting Puzzle 73: Polycystein

Closed since over 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Go Science 100 pts. 10,709
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,702
  3. Avatar for Russian team 3. Russian team 47 pts. 10,574
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 10,514
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 10,417
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 10,313
  7. Avatar for HMT heritage 7. HMT heritage 7 pts. 10,306
  8. Avatar for Contenders 8. Contenders 4 pts. 10,215
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 10,201
  10. Avatar for Team New Zealand 10. Team New Zealand 1 pt. 10,105

  1. Avatar for jausmh 11. jausmh Lv 1 5 pts. 10,419
  2. Avatar for Galaxie 12. Galaxie Lv 1 4 pts. 10,417
  3. Avatar for phi16 13. phi16 Lv 1 2 pts. 10,397
  4. Avatar for robgee 14. robgee Lv 1 2 pts. 10,381
  5. Avatar for Threeoak 15. Threeoak Lv 1 1 pt. 10,375
  6. Avatar for alcor29 16. alcor29 Lv 1 1 pt. 10,364
  7. Avatar for O Seki To 17. O Seki To Lv 1 1 pt. 10,306
  8. Avatar for georg137 18. georg137 Lv 1 1 pt. 10,215
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 1 pt. 10,188
  10. Avatar for ManVsYard 20. ManVsYard Lv 1 1 pt. 10,177

Comments