Placeholder image of a protein
Icon representing a puzzle

1743: Revisiting Puzzle 73: Polycystein

Closed since over 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
October 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Go Science 100 pts. 10,709
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,702
  3. Avatar for Russian team 3. Russian team 47 pts. 10,574
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 10,514
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 19 pts. 10,417
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 11 pts. 10,313
  7. Avatar for HMT heritage 7. HMT heritage 7 pts. 10,306
  8. Avatar for Contenders 8. Contenders 4 pts. 10,215
  9. Avatar for Gargleblasters 9. Gargleblasters 2 pts. 10,201
  10. Avatar for Team New Zealand 10. Team New Zealand 1 pt. 10,105

  1. Avatar for ZeroLeak7
    1. ZeroLeak7 Lv 1
    100 pts. 10,706
  2. Avatar for LociOiling 2. LociOiling Lv 1 97 pts. 10,698
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 93 pts. 10,611
  4. Avatar for Aubade01 4. Aubade01 Lv 1 89 pts. 10,605
  5. Avatar for vakobo 5. vakobo Lv 1 85 pts. 10,574
  6. Avatar for frood66 6. frood66 Lv 1 82 pts. 10,514
  7. Avatar for johnmitch 7. johnmitch Lv 1 79 pts. 10,510
  8. Avatar for Deleted player 8. Deleted player 75 pts. 10,457
  9. Avatar for Phyx 9. Phyx Lv 1 72 pts. 10,449
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 69 pts. 10,419

Comments