Placeholder image of a protein
Icon representing a puzzle

1747: Revisiting Puzzle 74: Platypus Venom

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
October 15, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,063
  2. Avatar for Contenders 12. Contenders 1 pt. 8,614
  3. Avatar for Team New Zealand 13. Team New Zealand 1 pt. 8,478
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,465
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 7,883
  1. Avatar for retiredmichael
    1. retiredmichael Lv 1
    100 pts. 9,721
  2. Avatar for LociOiling 2. LociOiling Lv 1 96 pts. 9,710
  3. Avatar for johnmitch 3. johnmitch Lv 1 92 pts. 9,702
  4. Avatar for dcrwheeler 4. dcrwheeler Lv 1 88 pts. 9,689
  5. Avatar for frood66 5. frood66 Lv 1 84 pts. 9,676
  6. Avatar for grogar7 6. grogar7 Lv 1 80 pts. 9,676
  7. Avatar for O Seki To 7. O Seki To Lv 1 77 pts. 9,669
  8. Avatar for ZeroLeak7 8. ZeroLeak7 Lv 1 73 pts. 9,656
  9. Avatar for Galaxie 9. Galaxie Lv 1 70 pts. 9,649
  10. Avatar for nicobul 10. nicobul Lv 1 67 pts. 9,647

Comments

LociOiling Lv 1

I'm still not seeing scoreboards in the client after about 12 hours. Other users are reporting the same thing.