Placeholder image of a protein
Icon representing a puzzle

1747: Revisiting Puzzle 74: Platypus Venom

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
October 15, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,063
  2. Avatar for Contenders 12. Contenders 1 pt. 8,614
  3. Avatar for Team New Zealand 13. Team New Zealand 1 pt. 8,478
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,465
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 7,883
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,735
  2. Avatar for Deleted player 2. Deleted player 73 pts. 9,727
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 52 pts. 9,720
  4. Avatar for fpc 4. fpc Lv 1 36 pts. 9,718
  5. Avatar for jausmh 5. jausmh Lv 1 24 pts. 9,698
  6. Avatar for O Seki To 6. O Seki To Lv 1 16 pts. 9,667
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 10 pts. 9,611
  8. Avatar for silent gene 8. silent gene Lv 1 6 pts. 9,610
  9. Avatar for Galaxie 9. Galaxie Lv 1 4 pts. 9,594
  10. Avatar for Deleted player 10. Deleted player pts. 9,575

Comments

LociOiling Lv 1

I'm still not seeing scoreboards in the client after about 12 hours. Other users are reporting the same thing.