1747: Revisiting Puzzle 74: Platypus Venom
Closed since over 6 years ago
Novice Novice Overall Overall Prediction PredictionSummary
- Created
- October 15, 2019
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK
Top groups
-
1. Beta Folders100 pts. 9,735
-
-
-
-
-
-
-
-
-
-
1. retiredmichael Lv 1100 pts. 9,721 -
-
-
-
-
-
-
-
-
Comments
LociOiling Lv 1
I'm still not seeing scoreboards in the client after about 12 hours. Other users are reporting the same thing.
bkoep Staff Lv 1
Stay tuned…