Placeholder image of a protein
Icon representing a puzzle

1750: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
October 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,928
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,766
  3. Avatar for DSN @ Home 13. DSN @ Home 1 pt. 9,564
  4. Avatar for Ukraine 14. Ukraine 1 pt. 9,555
  5. Avatar for Biology 2 15. Biology 2 1 pt. 9,163
  6. Avatar for Team New Zealand 16. Team New Zealand 1 pt. 8,987
  7. Avatar for Window Group 17. Window Group 1 pt. 7,652
  1. Avatar for Samuel Cinzah 121. Samuel Cinzah Lv 1 1 pt. 0
  2. Avatar for Itskk9997 122. Itskk9997 Lv 1 1 pt. 0
  3. Avatar for RAH 123. RAH Lv 1 1 pt. 0
  4. Avatar for packer 124. packer Lv 1 1 pt. 0
  5. Avatar for LanceKnight 125. LanceKnight Lv 1 1 pt. 0
  6. Avatar for jtscott 126. jtscott Lv 1 1 pt. 0

Comments